PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00073.1_g00039.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 288aa    MW: 32470 Da    PI: 8.4689
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00073.1_g00039.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.85.7e-391675261
                   zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                              +++lkcprC+s+ntkfCyynnyslsqPr+fCk+CrryWt+GG+lrnvP+Ggg+rk kks
  Rsa1.0_00073.1_g00039.1 16 DQQTLKCPRCNSSNTKFCYYNNYSLSQPRHFCKSCRRYWTRGGSLRNVPIGGGCRKTKKS 75
                             57899****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-33374IPR003851Zinc finger, Dof-type
PfamPF027014.3E-331874IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4782074IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102258IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MSSHTKKPPS STASQDQQTL KCPRCNSSNT KFCYYNNYSL SQPRHFCKSC RRYWTRGGSL  60
RNVPIGGGCR KTKKSIKPNI MAPSSSSAQR FFSSTMEEAS KFFPPPTAMD FQLAEISLNK  120
INDLQLMNNQ EVLGLRTTME QVGTTPVDVG SGLTLMGFGD YNTNNSSHSP ATFTTDENLA  180
TSIETLSCLN QDLHWRLQQQ RMAMFFGNSK QETVVVERPQ PLLYRNLEIV NSSPSPTTKK  240
GENQTEWYFG NNNDNERVIN NNDDNNKTGG SDQWNNGIQA WTDLNHYN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009130518.10.0PREDICTED: dof zinc finger protein DOF5.7-like
SwissprotQ9LSL61e-154DOF57_ARATH; Dof zinc finger protein DOF5.7
TrEMBLM4ESS30.0M4ESS3_BRARP; Uncharacterized protein
STRINGBra031853.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49502850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.11e-146Dof family protein